General Information

  • ID:  hor000929
  • Uniprot ID:  A0A0L0C0Z1
  • Protein name:  Sulfakinin-2
  • Gene name:  NA
  • Organism:  Lucilia cuprina (Green bottle fly) (Australian sheep blowfly)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lucilia (genus), Luciliinae (subfamily), Calliphoridae (family), Oestroidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0016020 membrane

Sequence Information

  • Sequence:  GGEEQFDDYGHMRF
  • Length:  14
  • Propeptide:  MLYPQQRIFNSMFLVFFLIVLSIFWLPIITARNLENSKSELRENSISGSSSGNGKMSSQYNNNPASAYYTAKHNLRSMLMAPKNYQQKLHSKIPLNIDLMDFLLEYEDEDRSKRFDDYGHMRFGKRGGEEQFDDYGHMRFGRSI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0L0C0Z1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000929_AF2.pdbhor000929_ESM.pdb

Physical Information

Mass: 191982 Formula: C73H98N20O25S
Absent amino acids: ACIKLNPSTVW Common amino acids: G
pI: 4.1 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -144.29 Boman Index: -4519
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 4173.57 Extinction Coefficient cystines: 1490
Absorbance 280nm: 114.62

Literature

  • PubMed ID:  23280433
  • Title:  Neuropeptidomics of the Australian Sheep Blowfly Lucilia Cuprina (Wiedemann) and Related Diptera